PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G141900.1.p
Common NameLOC101763902, SETIT_035794mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 433aa    MW: 47597.6 Da    PI: 9.7979
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G141900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.8e-24155199145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  Seita.9G141900.1.p 155 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 199
                         79****************************************997 PP

2QLQ55.12.3e-1997132237
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         +FT++Q+++L++Q+l+yKyL a++P+P+ Ll  i+k
  Seita.9G141900.1.p  97 PFTPSQWMELEHQALIYKYLHAKAPIPSSLLISISK 132
                         9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.2E-1096132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.43397132IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.4E-1497130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803155199IPR014977WRC domain
PfamPF088793.8E-20156198IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MSAGFCAAGA AAMELGDVMG MQQGVAVTAP SLRESDLGLL KRAGLTQAAA AAASYPSPFL  60
DEQKMLRFSK AAHALPSGVD FGRPNEQAFL LSRTKRPFTP SQWMELEHQA LIYKYLHAKA  120
PIPSSLLISI SKSFRSSNRV SWRPLYQGYT NADSDPEPGR CRRTDGKKWR CSKEAMADHK  180
YCERHINRNR HRSRKPVENQ PKKTAKDTPA AAAAGSLPCA VSQGSLKKAK VNDSKPGTVS  240
YWTDSLNRTM LSKEKANQQT EDNNTPLIKS TNRQPTLSLL SQLKQHNKPD KFSPAVDNAS  300
ISSDTILKAW ESINKHSQKS ISSTQLHDAE SLQSVLQNFS LAKNENMESE KNKYSDSMLV  360
SSTFYHSAEG PRTTCLTPNM TQVQADCISS SWEMPQGGPL GEILTNSKNS NDSNKKCDSR  420
SYGWLLNLDH AP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982189.10.0PREDICTED: growth-regulating factor 9-like
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLK4AA870.0K4AA87_SETIT; Uncharacterized protein
STRINGSi035794m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.18e-37growth-regulating factor 1